PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca005341G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 268aa    MW: 29849.6 Da    PI: 4.8574
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca005341G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
  Gh_Sca005341G01 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.54.8e-1670111447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++ E++l +d++ +lG++ W++Ia +++ gRt++++k++w+++
  Gh_Sca005341G01  70 LSEAEEQLVIDLHSRLGNR-WSKIAGRLP-GRTDNEIKNHWNTH 111
                      5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-21563IPR009057Homeodomain-like
PROSITE profilePS5129414.027961IPR017930Myb domain
SuperFamilySSF466894.9E-2711108IPR009057Homeodomain-like
SMARTSM007178.5E-131363IPR001005SANT/Myb domain
PfamPF002498.2E-151461IPR001005SANT/Myb domain
CDDcd001674.70E-91661No hitNo description
PROSITE profilePS5129426.67862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2464117IPR009057Homeodomain-like
SMARTSM007174.2E-1466114IPR001005SANT/Myb domain
PfamPF002494.1E-1470111IPR001005SANT/Myb domain
CDDcd001671.13E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SEAEEQLVID LHSRLGNRWS KIAGRLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLN KEAKAAENHI SETDGVGADS LEDNSSTPTE NCDNSSTPTE NCSSSVGSNS  180
LDKFCNDESL LSSLWMKDEP PLIDASWDIN IPTGGETCNG ISLPSWEENC AWLLDCQDFG  240
INDFGLDCLN DIELNTMNTL EMADKTVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.112291e-147boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5802758e-99JX580275.1 Gossypium hirsutum clone NBRI_GE12679 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471953.10.0PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-106ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0D2QM080.0A0A0D2QM08_G
STRINGPOPTR_0001s07830.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-101myb domain protein 42